General Information

  • ID:  hor002950
  • Uniprot ID:  P82003
  • Protein name:  Prothoracicostatic peptide
  • Gene name:  NA
  • Organism:  Bombyx mori (Silk moth)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function; GO:0005179 hormone activity
  • GO BP:  GO:0002168 instar larval development; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AWQDLNSAW
  • Length:  9(68-76)
  • Propeptide:  MRWCLFALWVFGVATVVTAAEEPHHDAAPQTDNEVDLTEDDKRAWSSLHSGWAKRAWQDMSSAWGKRAWQDLNSAWGKRGWQDLNSAWGKRAWQDLNSAWGKRGWQDLNSAWGKRDDDEAMEKKSWQDLNSVWGKRAWQDLNSAWGKRAWQDLNSAWGKRGWNDISSVWGKRAWQDLNSAWGKRAWQDMSSAWGKRAPEKWAAFHGSWGKRSSIEPDYEEIDAVEQLVPYQQAPNEEHIDAPEKKAWSALHGTWG
  • Signal peptide:  MRWCLFALWVFGVATVVTA
  • Modification:  T9 Tryptophan amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits ecdysteroid biosynthesis in the prothoracic gland of fifth instar larvae, with maximum inhibition during the spinning stage. When administered to day 8 fifth instar larvae it produces a significant delay in the commencement spinning behavior.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9XF04-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9XF04-F1.pdbhor002950_AF2.pdbhor002950_ESM.pdb

Physical Information

Mass: 123305 Formula: C50H67N13O15
Absent amino acids: CEFGHIKMPRTVY Common amino acids: AW
pI: 3.75 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 5
Hydrophobicity: -63.33 Boman Index: -1110
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 65.56
Instability Index: 2928.89 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1375

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry.
  • PubMed ID:  10531308
  • Title:  Bombyx Mori Prothoracicostatic Peptide Inhibits Ecdysteroidogenesis in Vivo